PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D02G0498
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family SBP
Protein Properties Length: 804aa    MW: 89816 Da    PI: 6.4106
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D02G0498genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP117.66.4e-37141216176
                  --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S- CS
          SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkk 76 
                  +Cq++gCe+d++e+k yhrrh+vC +++++++vl++g+++r+CqqC++fh ls+fDe+krsCrr+L++hn+rrr+k
  Gh_D02G0498 141 RCQIPGCEVDITELKGYHRRHRVCLQCANSSTVLINGESKRYCQQCGKFHLLSDFDEGKRSCRRKLERHNNRRRRK 216
                  6************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-28136203IPR004333Transcription factor, SBP-box
PROSITE profilePS5114129.547139216IPR004333Transcription factor, SBP-box
SuperFamilySSF1036123.14E-33141219IPR004333Transcription factor, SBP-box
PfamPF031108.6E-27142216IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 804 aa     Download sequence    Send to blast
MEQPASSPNT TLRGSPRSKD PQMDVHLPVT EADPSSSSVW DWGDLLDFTL DDHFSISLDD  60
GNMYPPPFEA SPSVPDPEPV SGPDRVRKRD PRMTCSNFLT GRVPCACPEI DEQMEKLEEE  120
EAGAPGKKRA RTGRVGSGTS RCQIPGCEVD ITELKGYHRR HRVCLQCANS STVLINGESK  180
RYCQQCGKFH LLSDFDEGKR SCRRKLERHN NRRRRKPVGS KTEVNKESLG ALQSEDIGCD  240
GEAGKDDLSL SGQTAEDPPF ESEDGLVSAD CSAPMLQTVN NDSTVALIDT GTDGGKEDLK  300
FSISTSYHDN RTAYSSMCPT GRISFKLYDW NPAEFPRRLR HQIFQWLADM PVELEGYIRP  360
GCTILTVFIS MPKNMWMKLS ENPMTYMHDF VFTPGRMLHG RGLMTIHLNN MIFRTSKGGS  420
SLVKLDMGVQ APRLHYVHPS CFEAGKPMEF VACGSNLLQP KLQFLVSFAG RYLPYDYCLA  480
SAHVNATEGS SSCDHLLYKI YVPQTESDLF GPVFIEVENQ SGLSNFIPVL IGDKDVCSEM  540
KVIQQGFDAS LFWGGSQISA NRSSCETSTL RQKAYSELVL DIAWLLREPK SENFQETMAS  600
SQIQRFNCLL NFLIQNKSTV ILKKVLQNLK NVMEEAGFNG TDDPDTRLLK KYMDYGRDIL  660
NNKLQEGERP VLLSEYIEQE GKWNSQSSLK NDGLFVPNGS QDLGERTNAK FQTMMASTTL  720
TRSETVPLLN KEIVMNVNLS KDLPRKSCST IFATTTLRSC PALFVVATAA ICLGICAVFL  780
HPNKVGEFAV TIRRCLSKRS YIIE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul5_A1e-42140218482squamosa promoter binding protein-like 7
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1202214RRKLERHNNRRRR
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00604PBMTransfer from AT5G18830Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012482069.10.0PREDICTED: squamosa promoter-binding-like protein 7 isoform X1
SwissprotQ8S9G80.0SPL7_ARATH; Squamosa promoter-binding-like protein 7
TrEMBLA0A0D2PN630.0A0A0D2PN63_G
STRINGVIT_05s0020g02160.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM63582644
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G18830.20.0squamosa promoter binding protein-like 7